99jeeveswaydigitalmarketingservices.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title 99 Jeevesway Digital Marketing Services – Digital Marketing Services | Local Business
Description N/A
Keywords N/A
Server Information
WebSite 99jeeveswaydigitalmarketingservices favicon www.99jeeveswaydigitalmarketingservices.com
Host IP 35.209.245.239
Location Mountain View, California, United States
Related Websites
Site Rank
More to Explore
3dstagers.com
abodeandshelter.com
aboveandbeyondcancer.org
addnewlink.de
act.com.jo
aea.net
afadi.info
africon2021.org
alexandertechnique.com
alkhawlaani.wordpress.com
tofinotowelco.com
torodenver.com
99jeeveswaydigitalmarketingservices.com Valuation
US$117,382
Last updated: Jul 22, 2020

99jeeveswaydigitalmarketingservices.com has global traffic rank of 2,896,989. 99jeeveswaydigitalmarketingservices.com has an estimated worth of US$ 117,382, based on its estimated Ads revenue. 99jeeveswaydigitalmarketingservices.com receives approximately 1,071 unique visitors each day. Its web server is located in Mountain View, California, United States, with IP address 35.209.245.239. According to SiteAdvisor, 99jeeveswaydigitalmarketingservices.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$117,382
Daily Ads Revenue US$64
Monthly Ads Revenue US$1,929
Yearly Ads Revenue US$23,476
Daily Unique Visitors 1,071
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 2,896,989
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
99jeeveswaydigitalmarketingservices.com A 14399 IP: 35.209.245.239
99jeeveswaydigitalmarketingservices.com MX 3599 Priority: 20
Target: mx20.mailspamprotection.com.
99jeeveswaydigitalmarketingservices.com MX 3599 Priority: 10
Target: mx10.mailspamprotection.com.
99jeeveswaydigitalmarketingservices.com MX 3599 Priority: 30
Target: mx30.mailspamprotection.com.
99jeeveswaydigitalmarketingservices.com NS 21599 Target: ns1.us73.siteground.us.
99jeeveswaydigitalmarketingservices.com NS 21599 Target: ns2.us73.siteground.us.
99jeeveswaydigitalmarketingservices.com TXT 14399 TXT: v=spf1 +a +mx +a:ns1.us73.siteground.us include:_spf.mailspamprotection.com ~all
99jeeveswaydigitalmarketingservices.com SOA 21599 MNAME: ns1.us73.siteground.us.
RNAME: root.us73.siteground.us.
Serial: 2020071906
Refresh: 3600
Retry: 900
Expire: 1209600
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Wed, 22 Jul 2020 12:28:53 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 256
Connection: keep-alive
Location: https://99jeeveswaydigitalmarketingservices.com/
Cache-Control: max-age=0
Expires: Wed, 22 Jul 2020 12:28:53 GMT
alt-svc: quic=":443"; ma=86400; v="43,39"
Host-Header: b7440e60b07ee7b8044761568fab26e8
X-Proxy-Cache: MISS

HTTP/2 200 
server: nginx
date: Wed, 22 Jul 2020 12:28:54 GMT
content-type: text/html; charset=UTF-8
x-cache-enabled: True
expires: Thu, 19 Nov 1981 08:52:00 GMT
cache-control: no-store, no-cache, must-revalidate
pragma: no-cache
link: <https://99jeeveswaydigitalmarketingservices.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://99jeeveswaydigitalmarketingservices.com/>; rel=shortlink
set-cookie: PHPSESSID=30f869164bceee9d479268b5b3d30c5f; path=/
vary: Accept-Encoding
alt-svc: quic=":443"; ma=86400; v="43,39"
host-header: b7440e60b07ee7b8044761568fab26e8
x-proxy-cache: MISS

99jeeveswaydigitalmarketingservices.com Whois Information
   Domain Name: 99JEEVESWAYDIGITALMARKETINGSERVICES.COM
   Registry Domain ID: 2546840250_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.namecheap.com
   Registrar URL: http://www.namecheap.com
   Updated Date: 2020-07-18T00:31:53Z
   Creation Date: 2020-07-18T00:24:46Z
   Registry Expiry Date: 2021-07-18T00:24:46Z
   Registrar: NameCheap, Inc.
   Registrar IANA ID: 1068
   Registrar Abuse Contact Email: abuse@namecheap.com
   Registrar Abuse Contact Phone: +1.6613102107
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: NS1.US73.SITEGROUND.US
   Name Server: NS2.US73.SITEGROUND.US
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain name: 99jeeveswaydigitalmarketingservices.com
Registry Domain ID: 2546840250_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2020-07-18T00:24:46.00Z
Registrar Registration Expiration Date: 2021-07-18T00:24:46.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: 
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411 
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code: 
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext: 
Registrant Fax: +51.17057182
Registrant Fax Ext: 
Registrant Email: 6e29d02c5e644be1973e97128667e1b8.protect@whoisguard.com
Registry Admin ID: 
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411 
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code: 
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext: 
Admin Fax: +51.17057182
Admin Fax Ext: 
Admin Email: 6e29d02c5e644be1973e97128667e1b8.protect@whoisguard.com
Registry Tech ID: 
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411 
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code: 
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext: 
Tech Fax: +51.17057182
Tech Fax Ext: 
Tech Email: 6e29d02c5e644be1973e97128667e1b8.protect@whoisguard.com
Name Server: ns1.us73.siteground.us
Name Server: ns2.us73.siteground.us
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/